SKU: 23445676197

Human PTH , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 1kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:11.1kDa Actual:12kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months.

-20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23445676197

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 5
Perfect gift for an electrician
Tough,great size and perfect my husband loves it stays cold for hours worth the money hard to dent or mess up. Great for an electrician
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 25, 2025
J
Verified Purchase
Joel Viamonte
Whiting, US
★★★★★ 5
I loved
Super good, it really keeps the cold well
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
M
Verified Purchase
mitzuh jasso
Boise, US
★★★★★ 5
Perfect Buy for you Hardworking Man/Women
I’ve bought my husband 3 of these already for work we love them easy to clean super durable perfect for his job. Keeps his coffee nice and hot and his chilled drinks nice and cool! We love it every chance we get we buy another one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
I
Verified Purchase
Ilda Espana
Los Angeles, US
★★★★★ 4
Doesn’t maintain hot too long.
I love this cup because the material is good for heavy duty jobs like mine. I took off one star because it does keep hot but not for super long, it lasts hot for about 2-3 hours. Other than that it’s easy to wash and the magnet that comes on the cup is super strong which comes in handy for not loosing it. It magnetized on to the cup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
A
Verified Purchase
Antonio Crissinger
Alexandria, US
★★★★★ 5
It's the best.
I'm picky on my coffee cups. Klien though has made a great cup for ones like me who work construction. This tumbler not only keeps your coffee hot, but is tough as hell. I can't count how many times it's fallen, dropped, or accidently kicked and still works like new. The rubber bottom and sides grip great. The magnet is strong and helps with tipping over, or possibly dropping. The locking lid also helps with spills.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2024

recommand products