SKU: 21750112012

Human Cathepsin B, His tag

Sale price$139.50 Regular price$155.00
Save 10%

Pay in installments of $38.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Cathepsin B, His tagProduct Specification Species Human Synonyms APP secretase (APPS), Cathepsin B1, CPSB Accession P07858 Amino Acid Sequence Protein sequence (P07858, Met1 Ile339, with C 10*His)

Product Specification


Species Human
Synonyms APP secretase (APPS), Cathepsin B1, CPSB
Accession P07858
Amino Acid Sequence

Protein sequence (P07858, Met1-Ile339, with C-10*His) MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 39.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cathepsin B belongs to a family of lysosomal cysteine proteases known as the cysteine cathepsins and plays an important role in intracellular proteolysis. In humans, cathepsin B is encoded by the CTSB gene. Cathepsin B is upregulated in certain cancers, in pre-malignant lesions, and in various other pathological conditions. Cathepsin B may enhance the activity of other proteases, including matrix metalloproteinase, urokinase (serine protease urokinase plasminogen activator), and cathepsin D, and thus it has an essential position for the proteolysis of extracellular matrix components, intercellular communication disruption, and reduced protease inhibitor expression. Cells may become carcinogenic when cathepsin B is unregulated. Cathepsin B has been proposed as a potentially effective biomarker for a variety of cancers. Overexpression of cathepsin B is correlated with invasive and metastatic cancers.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21750112012

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 5
Another great bed frame from Zinus
Size: Queen, Style: Leah
This is the 3rd or 4th or so Zinus bed frame I've purchased and just like the rest, the assembly is easy to follow, it's sturdy, and it looks great. They're also easy to break down and re-assemble in case of a move. The way they use Velcro for the slats to stick to the frame that otherwise ALWAYS fall at some point on other bed frames and is a pain to fix, makes it so much better. They also have a sticky thing on the slats to stick the mattress to the bed frame so the mattress doesn't slide around but I never need to use it. I assembled the bed frame by myself and it took less than an hour. I love that they include a little ratchet in the hardware. All the screws screwed in easily to all the places they needed to go. It's not too heavy. I have a 12 inch mattress so it does almost completely cover the bottom slat on the headboard. The pillows on my 12 inch mattress pretty much cover the headboard. They must use a really thin mattress for the product picture because my bedding engulfs 99% of the frame and you can barely see it, so be warned if you want the bed frame to be visible but have a high mattress/fluffy bedding. I got this one because I had a really low profile frame from them before and I wanted to utilize under bed storage. This has plenty of room to put things away underneath. Either way I really enjoy Zinus's products and will continue to purchase them in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2025
D
Verified Purchase
Domestic engineer
Battle Creek, US
★★★★★ 4
Nice bed, directions need improving
Size: Twin, Style: Leah, Size: Twin, Style: Leah
The assembly should have been so simple. But because of the directions using letters instead of numbers and the product pieces being identified with numbers not letters, it yielded confusion. What should have taken 30 minutes ended up taking over an hour with more head scratching than there should have been. Overall great piece. The box was severely damaged upon arrival and was taped up poorly. A few pieces fell out of the big hole in the box and got knicked up when bringing inside thebhouse...not worth returning over, but still unfortunate for a nice bed. All said, the bed looks nice and feels sturdy for my toddler.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025
K
Verified Purchase
Knicko Mojica
Pawtucket, US
★★★★★ 5
Solid Frame – Worth It, Just Be Patient with Assembly
Size: Full, Style: Kai
Long Review:
 Surprisingly solid bed frame—well-designed and very sturdy. The packaging was slightly damaged during shipping, but luckily the frame itself was untouched. The included ratchet tool was a lifesaver; tightening all those bolts gets tiring fast after the fourth or fifth piece. The instructions could use improvement. The printed manual uses letters for parts, while the frame itself uses numbers—this mismatch makes it a bit confusing at times. The numbered stickers are helpful, but without labels on the parts, you’ll have to rely on grouping them visually and cross-checking with the paper guide. Assembly doesn’t require much brainpower, but the most frustrating step was attaching the backboard. I recommend leaving all the bolts loose until everything is aligned; trying to force the bamboo headboard into place can lead to misalignment or even damage. TL;DR: Great bed frame, sturdy and simple to assemble. The ratchet tool is super helpful. Instructions are a bit confusing—but better than IKEA's. You got this!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2025
K
Verified Purchase
Kevin R.
Natrona Heights, US
★★★★★ 5
Looks great, not quite easy to assembly.
Size: King, Style: Leah
Mostly easy to put together. Instructions and it's labeling of parts was a bit confusing, but if you pay attention to orientation of parts and where the holes are at in the photo, you'll get it. We've been sleeping on it for 2 months now. No problems at all. Seems very sturdy and no creaking or squeaking. One bolt inset was stripped and wouldn't take the bolt (left middle crossmember) but with at least 1 in it, it's working fine. It's not load bearing really so it doesn't matter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
A
Verified Purchase
Aaron L
Fort Morgan, US
★★★★★ 5
Very nice!
Size: Twin, Style: Leah
This bed frame is fantastic, and was a lot easier to put together than some of the reviews would have you believe. The instructions were good, and the pieces of the bed were labeled with stickers to make it easy. It even came with a little ratcheting Allen wrench that made things faster. The bed doesn't wobble to creak, it looks nice, and it was affordable. I am very happy with it and I think that you will be too
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026

recommand products