SKU: 21676969522

Ephrin-A4 His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin-A4 His Tag Protein, HumanProduct Specification Species Human Accession P52798 Amino Acid Sequence Leu26 Gly171, with C terminal 8*His LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 24kDa (Reducing) Purity >95% by SDS PAGE&RP HPLC Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Accession P52798
Amino Acid Sequence

Leu26-Gly171, with C-terminal 8*His

LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

20-24kDa (Reducing)

Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

EPH-related receptor tyrosine kinase ligand 4 (Ephrin-A4) also known as EFNA4, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. An exception is the EphA4 receptor, which binds both subclasses of ephrins. Ephrin-A4/EFNA4 functions as a cell surface GPI-bound ligand for Eph receptor, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21676969522

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Russell Taft
Massapequa, US
★★★★★ 4
Not recommended for the aggressive player..
Size: 6 Inch, Color: Red, Size: 6 Inch, Color: Red
First this ball was not delivered when it should have been. Second, the tabs are poorly made. One day of my dog playing with it and the tabs are already torn up. The ball itself is fun for her and has not deflated for now at least.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
J
Verified Purchase
Jennifer S. Worley
Carnegie, US
★★★★★ 5
Tough little toy for super chewers.
Size: Shoes
Great my two Yorkies. Bought two. So far, still in one piece. UPDATE: This toy does not stand up to being washed. Since it is a "material" and not rubber, I would advise against buying it if you wash your dog toys. Sorry I bought several.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2025
V
Verified Purchase
Valentine's
Port Orchard, US
★★★★★ 1
Not a durable toy.
Size: Drop Ball, Size: Drop Ball
I was very disappointed in this rope toys. It took one day for my Border Collie to destroy it. The rope is not a durable material at all. I had a rope toy that was like this one several years ago, but it was much more durable. It lasted a couple of years. I think this one would be great for a small puppy, but not for an adult dog. Very disappointing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
M
Verified Purchase
MLove
Bozeman, US
★★★★★ 5
Fabulous play!
Size: Drop Ball
It is small for my 1 yr old girl boxer... my bad for not reading the product size details. The tug rope is great, but my rough boxer loved it too much and couldn't be trusted with it after much play. This toy opened the door for my purchasing tougher rope pull toys from the same brand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
M
Verified Purchase
Mrs. Tarbox
Cuba, US
★★★★★ 4
Good
Size: Four Packs
My dog loves them but two out of four have come untied
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026

recommand products