SKU: 19918358787

BIKE Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BIKE ProteinProduct Specification Species Human Accession Q9NSY1 1 Amino Acid Sequence S38 E345 SVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASE Expression System Baculovirus InsectCells Molecular Weight 36.

Product Specification


Species Human
Accession Q9NSY1-1
Amino Acid Sequence

S38-E345

SVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASE

Expression System Baculovirus-InsectCells
Molecular Weight

36.8 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 20 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19918358787

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julie Mc
Louisville, US
★★★★★ 5
Road of Bones was just what I needed!!!
Format: Kindle
⭐️⭐️⭐️⭐️.5 from me! The Road of Bones Silla Nordvig is running for her life from the Queen’s assassin and the King’s Claws (The Klaernar) but she doesn’t know why. She and her father were attacked by warriors on the road to home where he was killed, he admitted he wasn’t her true father, but that’s about all he could say before he died in her arms. Now, Silla has joined the Bloodaxe Crew, trying to make her way north on the Road of Bones to safety. The Road of Bones by Demi Winters is a Romantasy for those who absolutely love some romance with their fantasy. It’s Vikings and warriors at their finest. I felt the book was a little bit of a slow start, although there WAS action from the first chapter. But as soon as Silla realized she had to run for her life, the action was non stop. The plot was so well done, the story just built upon itself, and we learned more and more about Silla as her memories returned and her assassin got closer. As we discovered more about Silla, we learned more about the Bloodaxe Crew. Both Silla and the Bloodaxe Crew (each member) have such great back stories. Silla is such a well fleshed out character. We see her as a simple kitchen maid who has little self-esteem, but longs for the freedom to be herself, and we grow with her into a woman that knows herself and is ready for just about anything. She goes through so much on her journey on the Road of Bones and we are there with her for every minute. We get to see her fall in love, and we see her when she goes through betrayal. The way she reacts internally shows just how much she grew throughout her journey. The supporting characters, Jonas, Ilias, Hekla, and Rey were all extremely important to Silla’s story in his or her own way, and made the book all that much more rich and layered. Jonas seemed to have become enthralled with Silla, but things happen there that cause serious trauma. Hekla is a great friend to Silla and watching that relationship flourish was simply a joy, and Silla was able to come into her own as a warrior through Hekla’s tutelage (with Rey’s help). And, Rey, we can never forget about Rey…he was terrifying to Silla in the beginning, but somewhere he turns into a pillar of strength for her and I, for one, cannot wait to see what happens with that relationship. In the end, I consider Road of Bones to be a work of art. If you are looking for a Viking Romantasy that is fun, a little dark, and absolutely heartbreaking, this should be your next read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
L
Verified Purchase
Lark
Los Angeles, US
★★★★★ 3
I'm done
Format: Kindle
I survived. I made it through the book! This is a very slow book. Like... incredibly slow. I get that it's world building, but there also needs to be a sense that this world is worth caring about. The good side is that the author has lovely writing. And the audio book reader is fantastic. But the story itself is paced incredibly slowly and without the depth needed to care about the characters or world. I fell asleep a few times with the beautiful reader and lovely words... telling a story I just wasn't interested in The downside is that Silla is one of the most annoying main characters. She is weak and naive, with essentially no backstory. She's traveled all over with her father but apparently cooking and bread are her only skills. No worldliness. No experience with men or, well friends at all. Yet on the flip side she's able to learn fighting skills in a few weeks and starts outright flirting quite detailed within a few days. So is she a naive weak maiden or a hidden temptress warrior? No idea. Not sure she knows either. The other character backstories are also quite shallow. Like a few lines were written and that's all that needs to be said. But...it is lovely writing. I bought the 2nd book at the same time that I bought the first. I honestly have no desire to read the 2nd but curiosity has me wondering if it actually gets to storytelling.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2025
L
Verified Purchase
Literary Lure
Natrona Heights, US
★★★★★ 4
Wolves in disguise, magic, and political intrigue!
Format: Audiobook
📖 The Road of Bones by Demi Winters Rating: ⭐⭐⭐¾ (3.75/5) This book had me at "let them think us lambs, when truly, we are wolves." The Road of Bones delivers on atmosphere and world-building, though I was initially drawn in by promises of fantasy romance with a strong female lead. What I got instead was a first book that's laying serious groundwork - heavy on political intrigue and lighter on the romance than I expected. Silla Nordvig's journey along the thousand-mile Road of Bones is genuinely compelling. Fleeing after her father's murder with the queen's assassins on her tail, she's constantly testing her limits. The Viking-inspired setting feels fresh, and the magic system stands out as something I haven't seen before. When the Wolf tells her, "Careful, Sunshine. The sharp part bites," I couldn't help but smile at their developing dynamic. The pacing occasionally stumbles, but the character development keeps things moving. Silla's transformation from hunted to hunter unfolds beautifully against the backdrop of political machinations. The emotional moments hit hard, especially as she discovers her own strength in a world determined to break her. For a first book in a series, it establishes a solid foundation, though I wish the romance elements weren't quite so slow-burn. If you're looking for immediate romantic payoff, you might be disappointed, but if you enjoy watching characters and worlds unfold with patience, you'll find plenty to love here. 📦 What to Expect ✨ Epic Fantasy 💖 Slow Burn Romance 🔥 Grumpy/Sunshine Dynamic 🤯 Complex Politics & Power Struggles 💔 Deep Emotional Growth 🦴 Magical Beasts or Sentient Magic ⚔️ A Lead Who Fights for More Than Survival 📚 Book Tags Keywords: Dark Fantasy, Magic, Romance, Political Intrigue, Found Family, Survival, War Tropes: Grumpy/Sunshine, Enemies to Reluctant Allies, Found Family, Mentor/Protegé, Slow Burn, Power Couple Triggers: Slavery, Violence, War Themes, Grooming (discussed), Sexual Assault (mentioned, not shown), Emotional Abuse, PTSD 🎯 Final Thoughts If you're in it for the long haul and appreciate a fantasy that takes its time building something meaningful, The Road of Bones is worth the journey. Just know you're signing up for a series that's just beginning to show its teeth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2025
S
Verified Purchase
SR
Waukegan, US
★★★★★ 5
Good start to a series
Format: Kindle
I delayed reading the series for reasons I don’t remember. But my TBR list is huge so I thought I’d take a shot of this and I was pleasantly surprised. I didn’t think the blurb about it was anything special. But it was a very good book. It took some interesting twists and turns. I am so glad the second book is already out. Because I would not have waited patiently. Very slow burn but good storyline. 🔥🔥/5
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2025
J
Verified Purchase
Jammie Clark
Natrona Heights, US
★★★★★ 4
A good read
Format: Kindle
Multiple points of view. 3 Alpha men and an Omega male. She is a Beta in training for a new program placing betas in Alpha/Omega packs. Mila is only doing the program for the money to take care of her dad. She wasn't expecting to fall for a pack but when she sees this packs Omega she is done for. There is just something about him. His Alphas are good looking as well. Too bad she is hiding a secret and their government is acting shady. I liked it and can't wait to see where their story goes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2023

recommand products