SKU: 1974062818

Rhesus macaque IFNA13 Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 6 - Sep 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque IFNA13 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Interferon, alpha 13 Accession A0A5F8AJA6 Amino Acid Sequence Protein sequence (A0A5F8AJA6, Cys25 Leu182, with C His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL Expression System HEK293 Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Rhesus macaque
Synonyms Interferon, alpha 13
Accession A0A5F8AJA6
Amino Acid Sequence

Protein sequence (A0A5F8AJA6, Cys25-Leu182, with C-His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL

Expression System HEK293
Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFNA13, or Interferon Alpha-13, is a member of the type I interferon (IFN) family, a group of cytokines crucial for innate immunity against viral infections. It signals through the shared IFNAR1/IFNAR2 receptor complex to activate the JAK-STAT pathway. This leads to the expression of interferon-stimulated genes (ISGs) that establish an antiviral state in cells. IFNA13 is implicated in the early immune response. Research suggests its expression and potential roles may vary in different pathological contexts, including viral diseases and certain cancers, warranting further investigation into its unique biological activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1974062818

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amanda Burns
Cuba, US
★★★★★ 5
Caution can cause addiction
Style: Sport, Size: 12in
My dog has become addicted to tennis balls because of this! She sees the blue handle and she immediately loses her mind! I love it because I don't have to bend down as far to pick up the ball, which is amazing after 2 back surgeries.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
S
Verified Purchase
Sandy
Lexington, US
★★★★★ 3
12 " too short, no direction.
Style: Sport, Size: 12in
I got the twelve inch handle. It is too short and does not flex enough to release ball in right direction. Its almost impossible to aim and doesn't sent the ball far enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
A
Verified Purchase
Anthony Marcetti
Whiting, US
★★★★★ 5
Excellent balls
Color: 12 Tennis Ball, Color: 12 Tennis Ball
Good size and keeps my senior dog active. Very durable and they squeak
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2026
B
Verified Purchase
Beverly Elkins
Louisville, US
★★★★★ 5
Great toy my dog loves!
Color: 12 Tennis Ball
My dachshund, Winston, loves these balls because they squeak and of coarse it’s a ball. Only thing is he is destructive and the squeaker doesn’t last long but by far his favorite toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2023
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 4
Balls need to squeak out of the box
Color: 12 Tennis Ball
The squeaky ball lights up the faces of my dog shelter furiends, they love to fetch and chew the ball to make it squeaky. I have been buying these balls for about a year now. They don’t last long with some of the dogs, but the joy is worth the price. Lately some of the balls do not squeak right out of the box but many of the balls are fine. Returning the box doesn’t make sense because I used some already so I thought I would comment, dropping one star so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2025

recommand products