SKU: 19662647457

Ephrin-A3 Fc Chimera Protein, Human

Sale price$176.40 Regular price$196.00
Save 10%

Pay in installments of $49.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin-A3 Fc Chimera Protein, HumanProduct Specification Species Human Accession P52797 Amino Acid Sequence Gln23 Ser213, with C terminal Human IgG Fc

Product Specification


Species Human
Accession P52797
Amino Acid Sequence

Gln23-Ser213, with C-terminal Human IgG Fc

QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-70kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Eph receptors compose the largest family of receptor tyrosine kinases (RTKs), which are capable of recognizing signals from the cell environment and influencing cell-cell interaction and cell migration. Ephrins are the ligands to Eph receptors and they stimulate bi-directional signaling of the Eph-ephrin axis. Ephrin-A3 (EFNA3) is one of the ephrin ligands which could bind to EphA2, EphA3, EphA5, EphA7, EphA8 and more poorly to EphA4. It is not only expressed in skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine and peripheral blood leukocytes, but is also present in neuroblastomas, neural cancers and leukemias. The dysregulated expression of EFNA3 has been observed in many types of human cancer. The expression level of EFNA3 was found to be upregulated 26-fold in squamous cell lung carcinoma, 3.8-fold in liver cancer, 1.6-fold in colon cancer and downregulated 2.6-fold in kidney carcinoma, respectively.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19662647457

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Katie
Draper, US
★★★★★ 4
Good option for playing at night
Size: One-Size-for-Most
This ball is a good option if your dog likes to fetch at night. It stays lit for about 20 minutes or so, but that is me only leaving it out of the counter, being "charged" by whatever house lights are on. My dog isn't a big chewer, but it seems as though it would hold up well. I like that it is easy to rinse and clean. It seems to be a good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 16, 2026
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Night play
Size: One-Size-for-Most
My dog like many other dogs loves to play. We needed a ball that fit into the handheld thrower we had but something that we could find it at night. This has been wonderful!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
J
Verified Purchase
Jordan
Grantham, US
★★★★★ 1
It stopped working after three play sessions
Size: One-Size-for-Most
I thought this ball was great until a week later it stopped blinking and got lost in the snow. We only played with it for three days for 20 minutes at a time. It should’ve lasted a lot longer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
A
Verified Purchase
Amazon Customer
Phoenix, US
★★★★★ 5
It’s absolutely perfect for fetch in the dark!
Size: One-Size-for-Most
We needed to find a glow in the dark ball to run our over active dog after dark ( gets dark now about 5 pm ish) I was hesitant to buy this ball at first. We went to try it out and it totally blew my expectations! The ball really glows, it’s a durable rubber and when it hits the ground it lights up blue and red. Incredibly satisfied and just ordered 2 more. If you need to run your dog in the dark, this is absolutely for you. Highly recommend it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 5, 2025
L
Verified Purchase
Lynn
Chelsea, US
★★★★★ 5
Dog loved it
Size: One-Size-for-Most
Great! My dog loves taking it outside at night so he can see where it goes easier. Super bouncy, he has had it for over a year now and still not destroyed. Perfect size for his mouth too and easy to clean.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026

recommand products