Pay in installments of $49.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 7 - Sep 12
For Your Every Summer RSVP, with Code: SUMMER15
Description
Ephrin-A3 Fc Chimera Protein, HumanProduct Specification Species Human Accession P52797 Amino Acid Sequence Gln23 Ser213, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Accession | P52797 |
| Amino Acid Sequence |
Gln23-Ser213, with C-terminal Human IgG Fc QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 60-70kDa (Reducing) |
| Purity | >95% by SDS-PAGE&RP-HPLC |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Eph receptors compose the largest family of receptor tyrosine kinases (RTKs), which are capable of recognizing signals from the cell environment and influencing cell-cell interaction and cell migration. Ephrins are the ligands to Eph receptors and they stimulate bi-directional signaling of the Eph-ephrin axis. Ephrin-A3 (EFNA3) is one of the ephrin ligands which could bind to EphA2, EphA3, EphA5, EphA7, EphA8 and more poorly to EphA4. It is not only expressed in skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine and peripheral blood leukocytes, but is also present in neuroblastomas, neural cancers and leukemias. The dysregulated expression of EFNA3 has been observed in many types of human cancer. The expression level of EFNA3 was found to be upregulated 26-fold in squamous cell lung carcinoma, 3.8-fold in liver cancer, 1.6-fold in colon cancer and downregulated 2.6-fold in kidney carcinoma, respectively.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy