SKU: 188460180

Human TL1A/TNFSF15 Protein, His Tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TL1A/TNFSF15 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI Accession O95150 1 Amino Acid Sequence Protein sequence (O95150 1, Leu72 Leu251, with N His Tag)

Product Specification


Species Human
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TL1, VEGI
Accession O95150-1
Amino Acid Sequence

Protein sequence (O95150-1, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.2 kDa Observed MW: 25-30 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 188460180

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amy
Waukegan, US
★★★★★ 5
Bone for destroyers
Flavor Name: Bacon, Size: Small
4 months ago I Bought this bone for my 90lb lab who destroys all his bones, but not this one! It barely has any teeth/chew marks on it and it’s one of his favorites. It was a great find and I’ll be sure to buy again. If you have a dog that destroys bones I’d give this one a try.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026
D
Verified Purchase
DSW
Port Orchard, US
★★★★★ 5
Immediate Doggy Happiness!
Flavor Name: Bacon, Size: Medium
Great dog bones! These are a nice size for my 55-pound Aussie, as well as our 96-pound Alaskan Shepherd. They are big enough to last for a while, and big enough to see so that I don't step on them with my bare feet; part of this is that they stick up off the floor a bit, instead of being a flat bone, all in one plane.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
L
Verified Purchase
Lulu13
Louisville, US
★★★★★ 3
Nice size, the quality is changing. It is softer I believe than it used to be.
Flavor Name: Peanut Butter, Size: Large, Flavor Name: Peanut Butter, Size: Large
Not sure if something has changed in the way this product "Barkbone" is made. I bought this many times before and it lasted. Today, on my dogs first day of use, he had chipped through the material, and already destroying it. he has had it for less than 3 hours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2025
B
Verified Purchase
BARBARA KING
Dallas, US
★★★★★ 5
Very durable
Flavor Name: Steak, Size: X-Large
This is great for an aggressive chewer lady a long time very durable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
S
Verified Purchase
Sun Chi
Omaha, US
★★★★★ 5
Great long lasting chew
Flavor Name: Peanut Butter, Size: Large, Flavor Name: Peanut Butter, Size: Large
We really like having these bones on hand to keep our power chewing pitties busy. The large sizes are super convenient and long lasting, and our dogs really seem to enjoy them. We have gone through several orders over the last few years, and I anticipate to keep buying this brand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products