SKU: 18453825577

Human NUT, His tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NUT, His tagProduct Specification Species Human Synonyms Nuclear protein in testis, C15orf55, NUT Accession Q86Y26 Amino Acid Sequence Protein sequence (Q86Y26, Thr920 Ala997, with C 10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 10. 1 kDa Observed MW: 25 30 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Nuclear protein in testis, C15orf55, NUT
Accession Q86Y26
Amino Acid Sequence

Protein sequence (Q86Y26, Thr920-Ala997, with C-10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 10.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The nuclear protein in testis gene encodes a 1,132-amino acid protein termed NUT that is expressed almost exclusively in the testes, ovaries, and ciliary ganglion. NUT protein facilitates the acetylation of chromatin by histone acetyltransferase EP300 in testicular spermatids. BRD4 is the bromodomain-containing protein 4 gene. BRD4 protein involved in the development of neoplasms. The product of the BRD4-NUTM1 fusion gene, BRD4-NUT protein, stimulates the expression of at least 4 oncogenes, MYC, TP63, SOX2, and MYB in cultured cells. It is generally accepted that the BRD4-NUT protein promotes these neoplasms by maintaining their neoplastic cells in a perpetually undifferentiated, proliferative state. NUT carcinoma is a rare, highly aggressive malignancy. Studies have found that 66%-80% of NUT carcinomas harbor a BRD4-NUTM1 fusion gene while the remaining NUT carcinomas involve the BRD3-NUTM1, NSD3-NUTM1, ZNF532-NUTM1, or ZNF592-NUTM1 fusion gene.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18453825577

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
M Osekou
West Palm Beach, US
★★★★★ 4
Great for keeping bank statements clean but random security delays are frustrating
Reload type: One Time Reload
I use the balance reload tool to manage my monthly budget and easily hit credit card sign-up bonuses. It keeps my bank statements totally clean by grouping dozens of tiny e-book and movie rental charges into one single transaction. Most of the time the whole process works flawlessly and the money shows up in my account within five minutes. It is honestly the easiest way to put a hard limit on my family's everyday online shopping. You just need to watch out for a few annoying system quirks when you load larger amounts of money. Even though it usually works instantly the automated security filter sometimes flags big reloads and freezes the transaction for hours. This random delay is incredibly frustrating if you are trying to add cash fast to catch a lightning deal before it expires. You also have to remember that this balance is strictly non-refundable and cannot be used to buy other gift cards. Overall this is still a great method for organizing online spending and maximizing your cash-back credit card rewards. It totally fixed how I track household purchases but you definitely have to tolerate the occasional processing delays. My best advice is to load your account a day or two before you actually need to buy a big-ticket item. It works perfectly as a budgeting tool as long as you know the rules and plan for the random security hold.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
H
Verified Purchase
Humberto Villarreal
Lowell, US
★★★★★ 5
Fast
Reload type: One Time Reload
Super fast easy to use and reload
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
B
Verified Purchase
Bekhzod Uzokov
Battle Creek, US
★★★★★ 5
Fantastic for gaming and productivity, but missing USB-C rechargeability
Color: Classic Black, Color: Classic Black
I recently purchased the Razer Orochi V2, and overall, it is an amazing mouse. The build quality is absolutely fantastic, and it feels premium. It fits perfectly in my palm, and the materials and clicks have a very pleasant tactile feel. I use it daily for both gaming and work, and it performs flawlessly in both scenarios. Compared to my Razer Pro Click, the Orochi V2 actually fits my hand much better. In fact, I now only use the Pro Click as a backup for when the Orochi's battery suddenly dies! There is really only one downside for me: it runs on disposable batteries rather than having a built-in rechargeable one. On the plus side, it only needs a single battery to operate, and I love the clever design that allows you to use either a standard AA or a smaller AAA battery depending on your weight preference. However, I would really love to see a future version of this exact mouse with a built-in battery and a standard USB Type-C charging port. If you don't mind swapping batteries occasionally, this is a near-perfect mouse. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
G
Verified Purchase
Gogoferrari
Omaha, US
★★★★★ 5
Amazing mouse even for big hands.
Color: White
So I have big hands and what any big hand gamer understands is that you either have to get a big ol heavy G502 size mouse or use a certain grip to hold all these mice for smaller handed people. I previously owned a Model O, G pro, and Model O wireless. Having big hands my biggest peeve with all the other mice is that they’re ambidextrous mice so they are even harder to hold with fingertip/claw grips because the smooth, near flat, symmetrical sides. I only really make contact with the sides by pinching my fingers with them. I never make contact with the butt or base of the mouse with my grip. There’s where the Orochi changes things The Orochi somehow is a smaller mouse than all of the above but fills out my hand and grip SO much better. The sides actually have slight grooves so I don’t slip off the sides of my mouse and the shorter but bigger hump in the middle makes me for once actually feel the mouse in my palm if I want. Overall the feel is amazing. Battery life varies of course but I can barely tell there’s a battery in the thing even when flicking and the weight and balance of it feel so good. Mobile gaming is the main reason I got this mouse. I like that the dongle stores inside the mouse, uses batteries so I don’t have to worry about keeping it charged or bringing around extra cables to charge it, and the Bluetooth is good for casual gaming but doesn’t do great with big flicks so the 2.4ghz connection is required for esports games. Overall a great mouse and really awesome to game with and a little plus to it is that the shell comes off the back so satisfying, it’s hard to not fidget with it by taking it on and off haha. Well worth the money and I’d expect they’ll make a rechargeable one with all the success this mouse has accrued so far so if the swappable batteries don’t tickle your pickle, I’d just buy a sub $20 rechargeable battery station or just wait for a new rechargeable Orochi to come out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2021
T
Verified Purchase
Thomas
Lake Worth, US
★★★★★ 5
Unleash Your Gaming Potential
Color: White
The Razer Orochi V2 Mobile Wireless Gaming Mouse is nothing short of a gaming marvel. As a dedicated gamer, I've had the pleasure of using various gaming mice over the years, but the Orochi V2 stands out as a true game-changer. Here's why I can't help but sing its praises: Wireless Freedom: The wireless connectivity of the Orochi V2 is a game-changer. With Razer's HyperSpeed Wireless technology, I experienced zero lag or interruptions during intense gaming sessions. The freedom to move without being tethered by a cable is liberating. Compact and Portable: This mouse is designed with mobility in mind. It's incredibly compact and lightweight, making it perfect for gaming on the go. Whether you're a frequent traveler or just prefer a more minimalist setup, the Orochi V2 is the ideal companion. Exceptional Battery Life: The Orochi V2 boasts impressive battery life. I was pleasantly surprised by how long it lasts on a single charge. It easily survived through extended gaming marathons and even lasted me multiple days of regular use without needing a recharge. Customizable Performance: Razer's customization options are legendary, and the Orochi V2 doesn't disappoint. With the Razer Synapse software, you can fine-tune the mouse's sensitivity, button assignments, and lighting effects to suit your gaming preferences. Versatile Connectivity: The Orochi V2 doesn't limit you to just wireless gaming. It also offers Bluetooth connectivity, allowing you to seamlessly switch between devices. This versatility is a godsend for those who use multiple devices for work and play. Impressive Sensor: The 5G Advanced Optical Sensor delivers precise tracking and accuracy. Whether you're engaged in fast-paced FPS battles or navigating intricate RPG menus, the Orochi V2 responds flawlessly to your movements. Comfortable Design: Despite its compact size, the Orochi V2 is surprisingly comfortable to use. It's designed to fit various grip styles, and the textured side grips ensure a secure hold during intense gaming moments. In conclusion, the Razer Orochi V2 Mobile Wireless Gaming Mouse is a true gem for gamers who value performance, mobility, and customization. Its wireless capabilities, exceptional battery life, and versatility make it a standout choice for both casual and competitive gamers. Razer's commitment to quality and innovation is evident in every aspect of this mouse. If you're in the market for a compact and powerful gaming mouse that can keep up with your gaming lifestyle, the Orochi V2 should be at the top of your list. It has certainly elevated my gaming experience, and I couldn't be happier with this exceptional piece of gaming hardware.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2023

recommand products