SKU: 17833565496

CD52 Fc Chimera Protein, Human

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 7 - Sep 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD52 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Epididymis Secretory Sperm Binding Protein Li 171mP, CD52 Antigen (CAMPATH 1 Antigen), Epididymal Secretory Protein E5, He5, CDW52 Antigen, HEL S 171mP, EDDM5, CDw52, Cambridge pathology 1 antigen, Human epididymis specific protein 5, CD52 Accession P31358 Amino Acid Sequence Gly25 Ser36, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Epididymis Secretory Sperm Binding Protein Li 171mP, CD52 Antigen (CAMPATH-1 Antigen), Epididymal Secretory Protein E5, He5, CDW52 Antigen, HEL-S-171mP, EDDM5, CDw52, Cambridge pathology 1 antigen, Human epididymis-specific protein 5, CD52
Accession P31358
Amino Acid Sequence

Gly25-Ser36, with C-terminal Human IgG1 Fc GQNDTSQTSSPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

35-40kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Koyama K. et al. (2009) Functional aspects of CD52 in reproduction. J Reprod Immunol. 83(1-2): 56-59.

Background

CD52, also known as CAMPATH-1 antigen, HE5, and gp20, is a cell surface glycoprotein that can be targeted to induce immune suppression by complement-mediated cell lysis. CD52 is a GPI-anchored protein present in lymphocytes and male reproductive tissues (mrt) including mature sperm and seminal plasma. It has been shown that mrt-CD52 is synthesized in epithelial cells of the epididymis and vas deferens, but not in the testis. The mrt-CD52 is transported to mature sperm during sperm transition in the male reproductive tract. Lymphocyte CD52 functions to stimulate suppressor T cell induction, while mrt-CD52 is associated with seminogelin and involved in clot formation and liquefaction of semen. It protects sperm against anti-sperm antibodies by binding to C1q and inhibiting complement activation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17833565496

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AMW
New York, US
★★★★★ 5
Great Printer
Set name: Sublimation Printer
Great Printer, love it over my epson sublimation printer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
Y
Verified Purchase
yodan2
Chelsea, US
★★★★★ 5
Great value
Set name: Sublimation Printer
This is my first sublimation printer and I am very happy with this printer. The photos that I have printed have been very good quality and vibrant colors and have applied really well to the sublimation blanks I have used. I like that it will self clean the heads as long as the printer power is on. It was important to me to get an actual sublimation printer in order to have the warranty on it. The printer works with the Artspira app. This app is only available on a smart phone or tablet. It is very difficult to design on such a small screen. Brother needs to have a program that will work on a computer to make designing easier. I did gave difficulties getting my phone to connect to the printer after I designed my work on the very small screen. I used the chat feature on the Brother site and they were able to help me get it connected in order to print.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2024
B
Verified Purchase
Bruce
Lexington, US
★★★★★ 5
Printer
Set name: Sublimation Printer
Bought is a Christmas gift. Has not been turned off since. Lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
M
Verified Purchase
Ms.S.Butta
Omaha, US
★★★★★ 1
NOt good... not great... horrible
Set name: Sublimation Printer
I’m thoroughly disappointed with the Brother Sublimation Printer and would not recommend it. Out of the box, the setup process was more complex than anticipated, with unclear instructions and frequent errors. The print quality was inconsistent, with colors often coming out dull or inaccurate, despite multiple attempts at calibration. I experienced frequent paper jams, which disrupted my workflow and wasted a lot of materials. The printer’s software is buggy and doesn’t integrate well with other design programs, making it frustrating to use. The connectivity options were unreliable, causing frequent disconnections and delays. Additionally, the printer is quite noisy during operation, which can be distracting and bothersome. The build quality feels flimsy and not as durable as I expected. The customer support experience was also poor, with slow response times and unhelpful solutions. I faced issues with ink usage, as the cartridges seemed to run out quickly, leading to higher operational costs. The sublimation prints didn’t have the sharp, vibrant quality I was hoping for, making my final products look less professional. The lack of clear troubleshooting guides added to the frustration. The printer’s design is bulky and takes up more space than I anticipated. Overall, this Brother Sublimation Printer has been a letdown in terms of performance, reliability, and ease of use. I regret investing in this product and would advise looking for alternatives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2024
R
Verified Purchase
Roy Adorjan
Draper, US
★★★★★ 4
Pretty good for the price.
Set name: Sublimation Printer
So far so good. I have been producing a fair amount of items to date. My only wish was that the colors were more vibrant with this printer and it's ink.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025

recommand products