SKU: 17798136467

CD34 His Tag Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD34 His Tag Protein, HumanProduct Specification Species Human Synonyms CD34 Molecule, CD34 Antigen, Hematopoietic Progenitor Cell Antigen CD34 Accession P28906 1 Amino Acid Sequence Ser32 Thr290, with C terminal 8*His

Product Specification


Species Human
Synonyms CD34 Molecule, CD34 Antigen, Hematopoietic Progenitor Cell Antigen CD34
Accession P28906-1
Amino Acid Sequence

Ser32-Thr290, with C-terminal 8*His SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 55-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Civin C.I. et al. (1984) J. Immunol. 133:157. 2.Katz F. et al. (1985) Leuk. Res. 9:191. 3.Andrews R.G. et al. (1986) Blood 67:842.

Background

Cluster of Differentiation 34 (CD34) is a member of a family of single-pass transmembrane sialomucin proteins, and may function as a cell-cell adhesion factor by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.CD34 protein is selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. It has been widely used as a stem and progenitor cell marker, and clinical CD34+ stem cell transplantation (CD34+SCT) has been performed for tumor purging. CD34 monoclonal antibodies are widely used to identify and isolate hemopoietic progenitors and to classify acute and chronic leukemias.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17798136467

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Samie Bryner
Belleville, US
★★★★★ 5
Great fabric and quality
These shorts were a gift for my boyfriend who loved how comfortable they were!!! They washed very well bought them to match an army t shirt and they both matched perfectly!!! Size was perfect would definitely recommend these for the man in your life!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 26, 2026
D
Verified Purchase
Deviant
Birmingham, US
★★★★★ 5
Amazon not delivering after 2 days past delivery date
Size: 36, Color: Camo
These shorts are awesome some of my favorite but Amazon has delayed the out for delivery 2 days in a row now from the original 2 days was supposed to be delivered
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
K
Verified Purchase
KuroodoD
Lake Worth, US
★★★★★ 3
I love them but pockets tear easily
Size: 34, Color: #01black
I love them. They look nice and they are comfortable. I bought a total of three and they're all I wear in the summer. Unfortunately the strap pockets wear out easily. On my left pocket I store a ridge wallet and my keys. For two of my most worn pair, the strap tore up to where it no longer holds the pocket closed properly. On one of those in the same pocket, a hole ended up torn in the corner. The third one I had to throw out after it shrunk after being washed improperly (can't wash them like I did my previous shorts which I washed the same way as the rest of my clothes). I think I'll continue to wear them, maybe even buy one more, until I find something better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2023
S
Verified Purchase
Sean reddin
Waukegan, US
★★★★★ 5
Pocket and ability to hook my speaker to
Size: 32, Color: Black, Size: 32, Color: Black
I can't believe how comfortable they are and I'm very happy with all the pockets in the shorts. I bought the black as it my favorite color but will definitely be ordering all the colors available as they can be used as dress shorts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2025
C
Verified Purchase
Crosby
Draper, US
★★★★★ 5
Great shorts
Size: 34, Color: A-army Green
Ideal for everyday wear. I got 3 pairs before even trying them & I must say, they are really good. The pocket zippers get caught every now & then, but easy enough to correct. They look decent, easy wash & dry quickly, comfortable, plenty of pockets. Great buy for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2024

recommand products