SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 22 - Aug 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michelle
Pawtucket, US
★★★★★ 5
My chihuahua loves these
Size: 3.8 Ounce (Pack of 1), Style: Sweet Potato, Ring
My dog loves these so much its her favorite treat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
D
Verified Purchase
Donna
Birmingham, US
★★★★★ 5
Dog Treat
Size: 3.8 Ounce (Pack of 1), Style: Sweet Potato, Ring
My dogs really like these! It keeps them busy for a bit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2025
J
JVH
Port Orchard, US
★★★★★ 5
Winner, Winner! say My Three Dogs
Size: 3.8 Ounce (Pack of 1), Style: Sweet Potato, Ring
I'm always looking for different treats for my three dogs (10, 20 and 30 pounds, I don't ever recall giving my dogs anything with a pumpkin flavor, so I decided to trythese i-paw pumpkin flavored treats (I got the rings). All three of my dogs took the treat immediately and went off into their separate corners to chew away (one of my dogs is pretty fussy, so I was surprised she took it without hesitation). I'm no expert in dog treat ingredients, but I didn't see anything on the ingredients list that looked objectionable. While advertised as a rawhyde replacement, these rings don't last anywhere near as long as a rawhide, so while my dogs didn't wolf them down as fast as a conventional treat, they weren't left occupied for the half hour that a rawhide of this size might have kept them entertained (except for one of my dogs, who took an hour to finish hers, but she only has 7 teeth left in her mouth, so that's not really a fair comparison). I wouldn't hesitate to order these treats again for my pups.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2025
K
Kelly
Waukegan, US
★★★★★ 4
Lab tested. Lab approved. WAY too expensive.
Size: 3.8 Ounce (Pack of 1), Style: Sweet Potato, Ring
My dog likes these. But they don't really last all that long. And the package only included 5-6 rings. So that's an expensive treat, when I can get a bag of 40 dental treats (5" sticks) for the same price. Would I buy these again? No
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2025
M
Verified Purchase
Maria V. Ogoy
Carnegie, US
★★★★★ 3
Picky
Size: 3.8 Ounce (Pack of 1), Style: Sweet Potato, Ring
I've got a picky dog. He likes what he likes. He liked them at first but then lost interest.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026

recommand products