SKU: 14657050492

Human TMEM119, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 11 - Sep 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TMEM119, His tagProduct Specification Species Human Synonyms Osteoblast induction factor (OBIF) Accession Q4V9L6 Amino Acid Sequence Protein sequence (Q4V9L6, Thr118 Val283, with C 10*His) TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSVGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 19. 1 kDa Observed MW: 30 kDa Purity 90% by

Product Specification


Species Human
Synonyms Osteoblast induction factor (OBIF)
Accession Q4V9L6
Amino Acid Sequence

Protein sequence (Q4V9L6, Thr118-Val283, with C-10*His) TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSVGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 19.1 kDa Observed MW: 30 kDa
Purity >90% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

TMEM119 is known as a microglia-specific and robustly expressed trans-membranous molecule, which is not expressed by other macrophages and immune or neuronal cells, and forms, therefore, the most promising microglia marker to date. TMEM119 has served as a reliable immunohistochemical microglia marker for neurodegenerative diseases since then and was recently stained by an adapted protocol for immunocytochemistry even in postmortem CSF samples of trauma cases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14657050492

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeremy
Natrona Heights, US
★★★★★ 5
Amazing soap and lotion!
Style: Body Wash & AOO - Fragrance-Free
This lotion and wash is truly top notch and I love that it’s fragrance free. I’ll definitely be buying again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
W
Verified Purchase
Whit
West Palm Beach, US
★★★★★ 5
I promise just try it
Style: Body Wash & AOO - Fragrance-Free
I know it’s expensive but for us we love it. Clean ingredients. It’s worth it! I’ve used Tubby Todd on all my babies and it’s been a lifesaver! I buy it every month and now use it on my third baby—it’s gentle, effective, and works wonders for sensitive skin. The All Over Ointment especially helps so much with eczema and dry patches, keeping skin soft and calm. Such a reliable brand I keep coming back to again and again. Definitely a must-have for parents!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 11, 2025
T
Verified Purchase
TracyRandelhoff
Dallas, US
★★★★★ 4
Too expensive but great product.
Style: Body Wash & AOO - Fragrance-Free
Works so well for my little one that has eczema. Very gently and moisturizing set. Lot it. Just very expensive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2025
J
Verified Purchase
Jocelyn
Alexandria, US
★★★★★ 5
Worth it
Style: Body Wash & AOO - Fragrance-Free
I was helpless, needed to find something that would help my 7 week old’s itchy irritated skin on her face, neck and ears. Sensitive skin/eczema is genetic for us but I didn’t expect it to start so soon and it started as baby acne and then tiny red bumps all over. Nothing else was calming it down long enough for it to improve and she was so itchy it made me so sad to see her like that. This product is expensive but worth it to see your baby not being itchy and uncomfortable and I’m going to continue recommending it!! Within a day it drastically improved and her beautiful clear baby skin is back.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
S
Verified Purchase
Sue Anne G
Charlottesville, US
★★★★★ 5
Hydrated and protected
Style: SPF 50, Size: 5 Fl Oz (Pack of 1)
I loved this spf, as someone who’s had skin cancer multiple times now, protecting my skin is 100% a nonnegotiable (darn 80s and baby oil) this keeps me hydrated and protected at the same time! Easy, light cream like application without a weird white cast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products