SKU: 13075982961

Human ADAM23 Protein, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 21 - Sep 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ADAM23 Protein, His tagProduct Specification Species Human Synonyms Disintegrin and metalloproteinase domain containing protein 23, ADAM 23, Metalloproteinase like, disintegrin like, and cysteine rich protein 3 (MDC 3), MDC3 Accession O75077 Amino Acid Sequence Protein sequence (O75077, Ser60 His585, with C His tag)

Product Specification


Species Human
Synonyms Disintegrin and metalloproteinase domain-containing protein 23, ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 (MDC-3), MDC3
Accession O75077
Amino Acid Sequence

Protein sequence (O75077, Ser60-His585, with C-His tag) SRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLH

Expression System CHO
Molecular Weight Predicted MW: 61.2 kDa (pro) & 34.9 kDa (mature) Observed MW: 40-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

ADAM23 (A Disintegrin And Metalloproteinase 23) is a member of the ADAM family, known for its roles in cell adhesion and signaling. Unlike other ADAMs, it lacks proteolytic activity but interacts with integrins and extracellular matrix proteins, influencing neuronal development and synaptic plasticity. ADAM23 is highly expressed in the brain and has been linked to epilepsy and neurodegenerative disorders. It also plays a role in cancer progression, where its dysregulation affects tumor cell migration and metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13075982961

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Believer247
Lowell, US
★★★★★ 3
Mediocre salt and pepper grinders
Color: Upgrade Silver, Size: Rechargeable
Pros: They do work, and they are rechargeable. Cons: the motors run really slow, capacity is low, The charging tray you have to empty frequentlyto reduce buildup underneath the salt and pepper grinders.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
B
Verified Purchase
Bibi
Birmingham, US
★★★★★ 5
Sleek and classy
Color: Upgrade Silver, Size: Rechargeable
I love that these are rechargeable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
W
Verified Purchase
Walnut Creek Lady
Charlottesville, US
★★★★★ 5
Excellent Pepper Grinder
Color: Upgrade Black, Size: Rechargeable
I've had several pepper grinders over the years, and none was as easy and smooth to use as this one. It fills easily, and it grinds evenly and smoothly with a gentle press of the button. I am glad there are two, just in case one does give out, I will have the other to use, as I am not interested in grinding salt. It runs so effortlessly that you have to be a little careful when picking it up that you do not accidentally engage the button before you want the pepper to come out. I love it, and came back here after using it for two months just to let you know.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
G
Verified Purchase
GY
Louisville, US
★★★★★ 5
Greatest Kitchen Item I've Bought in Years
Color: Upgrade Black, Size: Rechargeable
These grinders are awesome. No more tedious grinding, or endless shaking! I love the adjustable grind levels (I like mine fairly coarse), and these hold a charge for a long time - months. My friends are super impressed when they visit, and will probably be buying these too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 5
Fast and efficient!
Color: Upgrade Black, Size: Rechargeable
These are a very nice set. Our other pair started grinding the salt and pepper as soon as you flipped it over and made a mess. This set here you have to push the button first. Also it is faster at grinding. Recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products