SKU: 13075763859

GITR/TNFRSF18 Fc Chimera Protein, Human

Sale price$250.65 Regular price$278.50
Save 10%

Pay in installments of $69.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GITR/TNFRSF18 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CD357 antigen, CD357, GITR, GITR D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid induced TNFR related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18 Accession Q9Y5U5 1 Amino Acid Sequence Gln26 Glu161, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CD357 antigen, CD357, GITR, GITR-D, GITRtumor necrosis factor receptor superfamily member 18, Glucocorticoid-induced TNFR-related protein, TNFRSF18, tumor necrosis factor receptor superfamily, member 18
Accession Q9Y5U5-1
Amino Acid Sequence

Gln26-Glu161, with C-terminal Human IgG Fc QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 40-50kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1,Nature Communications volume 12, Article number: 1378 (2021) Cite this article  5809 Accesses  9 Citations  1 Altmetric  Metrics.

Background

GITR(Glucocorticoid-induced Tumor necrosis factor Receptor), also known as AITR and TNFRSF18, is a 40 kDa transmembrane glycoprotein belonging to the tumor necrosis factor receptor (TNF-R) superfamily. Mature human GITR consists of a 137 amino acid (aa) extracellular domain (ECD) with three tandem TNFR cysteine-rich repeats, a 21 aa transmembrane segment, and a 58 aa cytoplasmic domain. GITR is expressed on CD4+CD25+ regulatory T cells (Treg) as well as on subsets of thymocytes, lymph node cells, and splenocytes. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13075763859

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kevick
Battle Creek, US
★★★★★ 5
Super Strong Hold with Magsafe & Sleek Design
I recently picked up this Tesla phone mount, and so far, I’m really impressed. The build quality feels solid, with durable plastic and a secure grip that holds my phone in place even on bumpy roads. Installation was straightforward—no tools needed—and it fits neatly behind the screen without blocking any view or controls. The magnetic ring provides extra stability, and the adjustable arms are wide enough to fit most phones, even with a case. It rotates smoothly for both horizontal and vertical viewing, which is perfect for navigation or hands-free calls. Overall, it’s a sleek, practical addition to the Tesla interior. If you’re looking for a minimalist, stable phone holder that blends well with the car’s design, this one’s definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 25, 2025
M
Verified Purchase
Manish
Natrona Heights, US
★★★★★ 1
Broke after 6 months
First the pros - strong magnet and does well what it's made for. Cons - the magnet came out after 6 months. So the product is of poor quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Keeps phone cool off phone charging pads!
I bought this magnetic phone mount for my Tesla Model X and it works great. The magnet is extremely strong and holds my phone securely, even over bumps and rough roads. Once it’s attached, the phone doesn’t move at all. Installation was quick and easy, and it fits the Model X interior nicely without looking out of place. It keeps the phone in a convenient spot for navigation or music without blocking the main screen. Overall, it’s a solid, well-made mount that does exactly what it’s supposed to do. If you have a Model X and want a strong magnetic phone mount, this is a great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026
R
Verified Purchase
rania
West Palm Beach, US
★★★★★ 5
Super Strong Magnet & Perfect Fit for My Tesla
I’m really happy with this Tesla phone mount. The magnet is extremely strong—my phone stays in place even when I’m driving on bumpy roads. Installation was quick and easy, and it attaches securely without blocking the screen or getting in the way. I love how clean and minimal it looks in the car. The rotation is smooth, and it makes it easy to check maps or take calls hands-free. If you want a reliable and sturdy phone mount that matches the Tesla interior, this one is perfect. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 27, 2025
M
Verified Purchase
Miguel Frias
Grantham, US
★★★★★ 4
Good quality, outstanding customer service
The mount is stylish; it looks great in a Tesla. The quality is good. However, the 2025 version broke after 1 year of use, which they fixed in 2026. The customer service is great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products