SKU: 56733472232

C1qR1/CD93 His Tag Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

C1qR1/CD93 His Tag Protein, HumanProduct Specification Species Human Synonyms C1q MBL SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix remodeling associated protein 4 Accession Q9NPY3 Amino Acid Sequence Thr22 Lys580, with C terminal 8*His

Product Specification


Species Human
Synonyms C1q/MBL/SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4
Accession Q9NPY3
Amino Acid Sequence Thr22-Lys580, with C-terminal 8*His TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 88-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Greenlee-Wacker M C. et al. (2011) Membrane-Associated CD93 Regulates Leukocyte Migration and C1q-Hemolytic Activity during Murine Peritonitis. J. Immunol. 187: 3353-3361.

2、Nepomuceno R R. et al. (1997) cDNA cloning and primary structure analysis of C1qRp, the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro. Immunity. 6: 119-129.

3、Nepomuceno R R. et al. (1998) C1qRp, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets. J. Immunol. 160: 1929-1935.

Background

Complement component 1q (C1q) receptor 1 (C1qR1, also known as C1qRp, or cluster of differentiation 93-CD93) is a 126-kDa type 1 transmembrane glycoprotein expressed in endothelial and hematopoietic cells, and responsible for C1q-induced phagocytosis. CD93 contains one C-type lectin domain and five EGF-like domains. Mature human CD93 consists of a 557 amino acid (aa) extracellular domain (ECD) with one C‑type lectin domain, four tandem EGF‑like domains, and a mucin‑like domain, followed by a 21 aa transmembrane segment and a 51 aa cytoplasmic domain. CD93 is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Soluble CD93 promotes the differentiation of monocytes to macrophages, phagocytosis of apoptotic cells, and inflammatory responsiveness to multiple TLR ligands.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 56733472232

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Casie Smith
Draper, US
★★★★★ 5
ROB is amazing.
Size: E25 Black
I have to first explain that I have named my E25, his name is now ROB and will be referred to as ROB going forward. ROB has been an amazing addition to our family and yes I said Family. ROB was easy to set up, all instructions were clear and easy to follow. The first day, I followed ROB everywhere afraid he would get stuck on a rug, or would have difficulty making it over the transitions of our flooring. But ROB had no problems what so ever. And honestly, I found myself amazed at the quality and endurance of ROB. He was jumping over transitions, flipping from mop to vacuum at the proper times and would suck up a dog hair bunny from 3 feet away! As a home with 2 big dogs (over 100 pounds each) that looses enough fur to make a new sweater everyday, ROB has done an amazing job! It’s been a week with ROB and I have found that he takes no prisoners, there was an area that I didn’t want him going into because I had boxes laid out, I was lazy and just made a make shift barrier so he wouldn’t proceed through the area, but ROB was persistent and was able to move the barrier so he could do his job. So, if you want a robot that will jump a shoe wall, ROB is your man! ROB navigates around a dog toys, around dog bowls, and can even get rid of the doggy dribbles when they drink. I have ROB set up to vacuum during the day and at night, he vacuums and mops. My 2 dog sons and my family are all happy with ROB as he is quiet and doesn’t scare them. Most days they just watch ROB do his magic on our floors. ROB also cleans himself, he will run home to clean his butt after mopping and will empty his own debris from his vacuuming. I really don’t know how I survived without ROB this long!! I waited 6 months before I finally purchased ROB after seeing his brother BOB in action at my Cousins house. So don’t be like me and wait, just make the purchase. You won’t regret it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
H
Verified Purchase
Haris
Cuba, US
★★★★★ 5
Probably the best robot vacuum mop you can buy in this price range
Size: E25 Black
Its pretty solid device. Honestly its so smart that it vaccumed and mopped my bathroom and ofcourse the wet hair stuck on the wet floor wasnt vacuumed the first pass but it then waited for the second pass to pick it up when it was dry. Made my entire house look so clean its actually amazing. It actually mops and get all the corners with dust. One thing thouhh is the side brushes tend to get tangled with hair and thread but uts very snap on snap off brushes so removing the stuck hair is super easy and only sometimes happens. The suction is amazing too its very strong. It moos the floor with clean water with solution so its actually cleaning well. Overall 10/10
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
I
Verified Purchase
Ismara
Draper, US
★★★★★ 5
The best vacuum cleaner ever!!
Size: E25 Black, Size: E25 Black
⭐⭐⭐⭐⭐ I honestly couldn’t be happier with the Eufy E25. I actually own two of them, and they’ve completely changed my daily routine. After spending a lot of money trying different brands, I finally found one that truly delivers everything I need in a vacuum. The suction power is impressive, it handles pet hair and debris effortlessly, and the mopping feature actually works (not just a light wipe like others I’ve tried). The self-emptying and self-cleaning system is a game changer—it saves so much time and maintenance. Navigation is smart and reliable, and it rarely gets stuck. It covers my floors efficiently and leaves everything noticeably cleaner. I also love how low-maintenance it is overall. If you’re tired of wasting money on vacuums that don’t live up to expectations, this is absolutely worth it. For me, it has truly been life-changing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
I
Verified Purchase
itsmeray
Chelsea, US
★★★★★ 3
Updated 1/28/2020 update 1/17/2020 It's been everything it was advertised to be and more. (Not)
Size: 11S
I called Amazon again today. Explained the situation and that no one from Amazon or Eufy had returned my calls as they promised. Also after replacing the battery at my own expense it ran 90 minutes again but got stuck everywhere, made this weird ratcheting type noise every time it changed surfaces and finally today just beeped at me twice and died. Supposedly that indicates a seized brush but they all spin freely. This time I just flat out asked them to look at my Amazon account and replace it, as I'm a very good customer. New one will be here tomorrow. I'll do a separate review on that one as it took me forever to find this one again. I'll also let you know if it's a refurbished unit or not. Well wouldn't you know it. I leave a nice review and a few days later, Murphy's law rears it's ugly head. Device is 3 months old a couple weeks out of the exchange warranty and the battery is shot. Runs 5 or 10 minutes on a full charge. Called Amazon to see if since I am a really long standing customer if they'd help me out. Nope but we'll call Eufy support on your behalf and they will call you. We will also call you to follow up. I've been a customer service manager a lot of years and this is where employees can kill you. This Amazon person made me multiple promises. It's been a week no call from Eufy, no call from Amazon. You just turned 4 stars into 1 and if this is all the longer the batter lasts don't bother because the replacements are $25 to $30 bucks depending on the brand. I'm not spending a hundred bucks a year on batteries and this thing should be under warranty. After 3 days I ordered a new battery and Rosie is running again but I'm no longer pleased and the next time I'll buy another brand. If if this battery doesn't last the whole thing goes in the trash and I buy something else. I run this every day maybe the batteries won't take that I don't know. But if you're going to run it every day buy something else. This didn't last long enough at all. I wanted to wait a while to be sure I had a good sampling and could post a fair and useful review. It's been 90 days now. We have two large (bigger than standard) labradoodle puppies. 85 and 50 pounds and they're 1st generation so they shed a lot. They also, being puppies, have tore the yard up so it is basically a mud pit and they wrestle, run, and fight constantly. They put a lot of dirt and hair on the floors and in the air. We run "Rosie" every day. Yes my wife named it. It does an amazing job on our hardwood floors and throw rugs. It gets all the hair and an incredible amount of dust and dirt. What I mean by that is we can run our Dyson or the Shark Pet vacuum and then run Rosie and the chamber will be full of dust and dirt when she's done. It's almost disconcerting to know our very expensive upright vacuums leave so much behind. It also has the unadvertised ability to buff our hardwood floors. They shine when she's done and the beater brush is showing no signs of damaging the finish on our floors. I would disagree with some of the reviews and even the manufacturers assertion that it doesn't work well on dark floors. Our hardwood floors are a dark reddish brown. The device works great on them and as I said when it's finished they shine. We have agreed we will never be without one and love this device. It does everything it has been advertised to do and more. Also it is set to automatic power and runs longer than the advertised time on a full charge. We get about 2 hours and 15 minutes. We've put down an additional 6 throw rugs for the rainy snow season in the path where the dogs run when they come in and the time has dropped to around 90 to 100 minutes. Still long enough to cover everything well and more than once. It does keep going until it needs a charge it doesn't just run and go back to the dock. I've noticed in the open areas like our living room it might hit that 2 or even 3 times. The floors are like glass after that. Now for the negatives, and these are not deal breakers I'm just being fair. The dirt and dust I referred to is new to us. we recently moved from Illinois to Ohio. In Illinois the dirt is black. Here it is red or a very light brown. The vacuum gets externally dirty. It gets covered with dust/dirt and does not look good. The device is black and the dust is light colored and is readily apparent. I don't want to put it away all the time or for company so thats a problem for me and more cleaning which is not advertised so I'm mentioning it. Secondly it needs to be emptied every use or every other use. They are all like that except some of the super expensive robot vacuums so I wouldn't mention it except for my third negative. It is hard to clean from a mess standpoint. Not so much with the pet hair but with the dust. When you dump it the dust goes everywhere. Unless you have an empty trash can so you can get it way down inside when you're done the garbage can lid and sometimes the floor around the garbage can is clearly dusty from emptying the vacuum. The filters need to be removed at least every other running and they are also a big dusty mess. I also don't believe they will last as long as advertised. I have an air compressor in the garage and a hand held electric air compressor and use those to clean the filter. The foam piece I rinse in the sink. I don't think that someone without access to those tools is going to get the life out of the filters thats advertised. The device comes with a set of replacement filters and the rotating brushes. Not the beater bush though. Our unit is 3 months old. I had to replace the filters at about 40 days and tried to make them last a little longer this time but it hasn't worked out. The outside of the device is filthy. I believe this is due to the filters. The brushes have lasted longer than the suggested replacement time. They are 90 days old and still look like new. Last and has been a rare negative. The device will get stuck under things. Once I learned what the obstacles were in our home it was easy to fix. Some areas I blocked with rolled up moving blankets. I pull the chairs out from under the kitchen table to allow room for it to maneuver. If I don't it gets under there and spends way too much time cleaning and trying to get out. I'd rather it spend less time under there so it can do the whole cleaning area and have power left to do it again. I had the problem spots corrected and figured out within the first 30 days. I've read some units have a tape or something the vacuum will sense and avoid. I wish this unit had that but then again at this price point that is probably an unfair expectation. So those are the pro's and con's we've encountered. The con's are all minor irritants and not a reason not to buy the device as all of these devices are prone to these issues except one or two of the very very expensive units. To repeat what I said earlier this device has worked out so well we have decided that we will never be without one and that when the time comes to replace her we will not feel bad about spending the money for a high dollar unit as it is worth it. Time is worth more to us than money and this thing saves us a great deal of time. It does great job, has done no damage to anything, and if it weren't for the clean up issues would be a five star review. I hope this helps someone make an informed decision and I hope you buy one. It's an amazing little machine, stands up to all the reviews, and truly is the best bang for your buck in robot vacuums.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2020
D
Verified Purchase
Designer77
Lowell, US
★★★★★ 5
Amazing cleaning partner!! Love!
Color: Black - 03
This is my first robot vacuum and I'm in love with it! I love being able to be doing something else, folding laundry, making dinner etc while this is cleaning the floors. Harry, as I've named him, is my cleaning partner. While it by no means replaces the suction on a standard push vacuum It's great at those between cleanings to keep things picked up. We have a dog with long white hair and a cat so hair clean up is always an issue and I'm very ocd about my house being clean. The suction doesn't leave my thick carpet hair free by any means but it's a great help to keep up with it. I read a lot of reviews before buying so wanted to share my experience after having this about two months now and using several times a week. I vacuum the house during the week with Harry and he mops my hard floors on the weekend...and I do a stand up vacuuming with my big vac on the weekend. I hope this helps you! Here are some of my thoughts on how this thing "Harry" works: MOPPING. This feature is amazing!!! And one of the few robo vacs with the option. I love being able to put a little cleaner and water in the bin and let it do its thing. This model doesn't have the ability to map rooms you want it to clean in (if your carpet butts up to hard floors) but I found an easy solution. As my bar stools and garbage cans need to be moved so Harry can mop everything I just use them to block off my great room so it stays on the hard floors. Leaves my floors pretty dang clean and smelling good, while I do other things! You can also buy magnetic tape to block room's but I don't see the need with my blocking technique, and I just close the doors to my carpeted bedrooms. Wet the pad on the bottom before starting to help get it going, the water in the container slowly seeps out so getting the pad wet ensures its starts mopping right away. Will need to refill water bin about every 30 min. I use a little fresh scent pine sol then fill rest with water. SUCTION. The suction is great on hard floors gets everything up. The side sweeper is great against walls and cabinets. I have thick carpet so didn't expect it to suck everything up but it does a great job. Still leaves my dogs hair behind a bit. I use my big vacuum once a week for a deeper cleaning. For what it is this little guy does pretty good! OBJECT AVOIDANCE. My husband wanted the model that is twice the price or more that has the laser mapping eye. Not sure how that works but for the price this works just great! It senses something before running into it, slows down then gently bumps it and turns around. Also the low profile is great for getting under beds and dressers where hair and dirt hides, love this! Not saying I wouldn't like the laser mapping eye but didn't want to spend 2x+ the amount and this has proven to work really well. NAVIGATION. While I know other models are more technologically advanced again for the price this works great. It vacuums in straight lines which is great for my ocd. If it runs into an obstacle it can get off track from those lines as its works it's way around things. Sometimes it seems confused and goes back and forth in the same area, but generally works itself out and keeps going. I would like to be able to control where it goes in the house but not available on this model, but again for the price I'll say I don't really mind. I just let it go where it wants or shut it in an area if I want it to stay in there. BATTERY. The battery is pretty great. Runs for 2+ hours before needing to charge. I have a 2,700 sf rambler and it can't get through the whole house before needing to charge. If it were a tad more efficient in navigation it probably could, but does spend some time trying to figure out where it is and where to go. I just charge it and set it loose on the other side of the house. MAP/APP It has a map feature that is only to show you where it went during the clean up. You can't interact with the map or tell the vaccum to work in certain areas with it. But I knew this when I bought it so wasn't expecting that. If you are looking for a vacuum you can tell where to go then spend more for the upgraded models. I don't feel a huge need for this, works fine for me. The app is more for basic settings, you can turn it on and off and see what it's doing, battery life, have it call out to you if you can't find it. You can hook to Alexa which is awesome to say "tell Harry to start" and off it goes. Again you can't control its direction or rooms work the app it's more for stop/go and basic settings and maintenance. STAIRS. We have a sunken living room with a step.down the whole length if the room, hasn't fallen once. Its senses the step, and moves away, kinda bounces along the step turning, Sensing and moving it's way along it. Perfect. DUST BIN. this model has one of or the largest bins on the market, its holds a lot for hours of work. It's easy to access right on top, open the side and empty. The filter pops out so you can clean it, found taking outside and bumping on concrete left a good amount of dirt. NOISE. I think it's pretty quiet for a vacuum cleaner. I only have my noisy stand up to compare to and its much quieter than that. It's basically just the light suction noise, I don't hear the motor at all. OVERALL. For the price this is the best investment I could have made to help keep my house clean during the week while I'm busy with work. I love being able to start it and walk away accomplishing other things and come back to clean floors. It's a little misguided at times but nothing bad. I'm sure more expensive models are a bit more intelligent but for $350 this is the best option out there. I would highly recommend if you need a helping hand. My favorite feature is the mopping, I hate mopping floors and this does the job for me! This thing is amazing and I can't believe I've never had one, will never be without now! Happy cleaning!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2019

recommand products